PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_20013-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family GATA
Protein Properties Length: 372aa    MW: 42307.4 Da    PI: 8.0974
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_20013-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA542.2e-17294328135
             GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                      C++C + +Tp+WR+gp g+ktLCnaCG++y++ +l
  TRIUR3_20013-P1 294 CTHCLSHTTPQWRSGPLGPKTLCNACGVRYKSGRL 328
                      *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004015.8E-4175228IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.103.3E-4180214IPR013088Zinc finger, NHR/GATA-type
PROSITE profilePS501148.629184213IPR000679Zinc finger, GATA-type
SMARTSM004013.6E-16288342IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.543288324IPR000679Zinc finger, GATA-type
SuperFamilySSF577164.56E-14292352No hitNo description
Gene3DG3DSA:3.30.50.102.9E-13293326IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.73E-13293340No hitNo description
PROSITE patternPS003440294319IPR000679Zinc finger, GATA-type
PfamPF003203.0E-15294328IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009416Biological Processresponse to light stimulus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    Send to blast
MDRNVQGAKG TWATTEPRVE RRRRQVGAVA QGGAVEVRQG LGSGVGDTVA TSVSVYAESE  60
DSSRTEWVSI YLEDCLSNPA SYPVSEEQAS VNPKLPHPSS SNARRKKRSL ASVIRDSDEE  120
YFLIVEPPLL LDQKHWLAES ELILPKKDKD QELVQKPEQE NEEEYKPYTV QFKQEQVVMR  180
CNICLSNSNQ TPQQWQGGPS GALLCNTCSL RLKAGNGFIK LERCGQQVDE EQDHGRGQDK  240
RKIKKTTYYG DDEEPPQEKR RIKKTSFVDE QGKRRTKKTY VNEEVPLEEP VKRCTHCLSH  300
TTPQWRSGPL GPKTLCNACG VRYKSGRLLP EYRPANSPTF VSFMHSNSHK KVMQMRKSVE  360
NEHEHEYSHS DM
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00415DAPTransfer from AT3G60530Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2517110.0AK251711.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf124o21, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003579113.11e-120PREDICTED: GATA transcription factor 2-like
TrEMBLM7YV480.0M7YV48_TRIUA; GATA transcription factor 4
STRINGBRADI4G01140.11e-120(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP59623656
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60530.12e-35GATA transcription factor 4